Loading...
Statistics
Advertisement

COPPERTILES.RU
www.coppertiles.ru/
RU-CENTER - регистрация доменных имен .РФ, .RU, .SU, .COM... Хостинг сайтов и DNS-серверов. Продажа Р...

Coppertiles.ru

Advertisement
Conversion Technology Metas Server
Coppertiles.ru is hosted in Russian Federation / Moscow . Coppertiles.ru doesn't use HTTPS protocol. Number of used technologies: 2. First technologies: CSS, Html, Number of used javascripts: 0. Number of used analytics tools: 0. Its server type is: nginx.

Technologies in use by Coppertiles.ru

Technology

Number of occurences: 2
  • CSS
  • Html

Advertisement

Server Type

  • nginx

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Founded!
visitors List Not founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Not founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Coppertiles.ru

Missing HTTPS protocol.

    Meta - Coppertiles.ru

    Number of occurences: 6
    • Name: description
      Content: RU-CENTER - регистрация доменных имен .РФ, .RU, .SU, .COM... Хостинг сайтов и DNS-серверов. Продажа и покупка домена на аукционе. Освобождающиеся домены.
    • Name: keywords
      Content: домен, регистрация доменов, РФ, RU, COM, аукцион доменов, хостинг, почта, освобождающиеся домены
    • Name: application-name
      Content: nic.ru
    • Name: msapplication-TileImage
      Content: http://nic.ru/images/w8/win8transp.png
    • Name: msapplication-TileColor
      Content: #3399FF
    • Name:
      Content: RU-CENTER

    Server / Hosting

    • IP: 194.85.61.76
    • Latitude: 55.75
    • Longitude: 37.62
    • Country: Russian Federation
    • City: Moscow

    Rname

    • statuspage1.nic.ru
    • statuspage2.nic.ru
    • nomail.nic.ru

    Target

    • hostmaster.nic.ru

    HTTP Header Response

    HTTP/1.1 200 OK Server: nginx Date: Thu, 26 May 2016 00:41:42 GMT Content-Type: text/html; charset=utf-8 X-Cache: MISS from s_bd39 X-Cache-Lookup: MISS from s_bd39:80 Via: 1.1 s_bd39 (squid/3.5.19) Connection: keep-alive

    DNS

    host: coppertiles.ru
    1. class: IN
    2. ttl: 600
    3. type: A
    4. ip: 109.70.26.37
    host: coppertiles.ru
    1. class: IN
    2. ttl: 600
    3. type: A
    4. ip: 194.85.61.76
    host: coppertiles.ru
    1. class: IN
    2. ttl: 3600
    3. type: NS
    4. target: statuspage1.nic.ru
    host: coppertiles.ru
    1. class: IN
    2. ttl: 3600
    3. type: NS
    4. target: statuspage2.nic.ru
    host: coppertiles.ru
    1. class: IN
    2. ttl: 3600
    3. type: SOA
    4. mname: statuspage1.nic.ru
    5. rname: hostmaster.nic.ru
    6. serial: 1464218114
    7. refresh: 86400
    8. retry: 7200
    9. expire: 604800
    10. minimum-ttl: 86400
    host: coppertiles.ru
    1. class: IN
    2. ttl: 600
    3. type: MX
    4. pri: 0
    5. target: nomail.nic.ru

    Common Typos/Mistakes

    This list shows You some spelling mistakes at internet search for this domain.

    www.oppertiles.ru, www.cdoppertiles.ru, www.doppertiles.ru, www.croppertiles.ru, www.roppertiles.ru, www.ctoppertiles.ru, www.toppertiles.ru, www.cvoppertiles.ru, www.voppertiles.ru, www.cfoppertiles.ru, www.foppertiles.ru, www.cgoppertiles.ru, www.goppertiles.ru, www.choppertiles.ru, www.hoppertiles.ru, www.cnoppertiles.ru, www.noppertiles.ru, www.cmoppertiles.ru, www.moppertiles.ru, www.cjoppertiles.ru, www.joppertiles.ru, www.cppertiles.ru, www.cobppertiles.ru, www.cbppertiles.ru, www.cohppertiles.ru, www.chppertiles.ru, www.cogppertiles.ru, www.cgppertiles.ru, www.cojppertiles.ru, www.cjppertiles.ru, www.comppertiles.ru, www.cmppertiles.ru, www.co ppertiles.ru, www.c ppertiles.ru, www.covppertiles.ru, www.cvppertiles.ru, www.copertiles.ru, www.copipertiles.ru, www.coipertiles.ru, www.copkpertiles.ru, www.cokpertiles.ru, www.copupertiles.ru, www.coupertiles.ru, www.copjpertiles.ru, www.cojpertiles.ru, www.coplpertiles.ru, www.colpertiles.ru, www.copertiles.ru, www.coppiertiles.ru, www.copiertiles.ru, www.coppkertiles.ru, www.copkertiles.ru, www.coppuertiles.ru, www.copuertiles.ru, www.coppjertiles.ru, www.copjertiles.ru, www.copplertiles.ru, www.coplertiles.ru, www.copprtiles.ru, www.coppexrtiles.ru, www.coppxrtiles.ru, www.coppesrtiles.ru, www.coppsrtiles.ru, www.coppewrtiles.ru, www.coppwrtiles.ru, www.copperrtiles.ru, www.copprrtiles.ru, www.coppefrtiles.ru, www.coppfrtiles.ru, www.coppevrtiles.ru, www.coppvrtiles.ru, www.coppecrtiles.ru, www.coppcrtiles.ru, www.coppeqrtiles.ru, www.coppqrtiles.ru, www.coppeartiles.ru, www.coppartiles.ru, www.coppeyrtiles.ru, www.coppyrtiles.ru, www.coppetiles.ru, www.copperitiles.ru, www.coppeitiles.ru, www.coppeotiles.ru, www.copperltiles.ru, www.coppeltiles.ru, www.copperltiles.ru, www.coppeltiles.ru, www.copper.tiles.ru, www.coppe.tiles.ru, www.copperiles.ru, www.coppertqiles.ru, www.copperqiles.ru, www.coppertailes.ru, www.copperailes.ru, www.coppert iles.ru, www.copper iles.ru, www.coppertwiles.ru, www.copperwiles.ru, www.copperteiles.ru, www.coppereiles.ru, www.coppertziles.ru, www.copperziles.ru, www.coppertxiles.ru, www.copperxiles.ru, www.coppertciles.ru, www.copperciles.ru, www.coppertles.ru, www.coppertirles.ru, www.coppertrles.ru, www.coppertifles.ru, www.coppertfles.ru, www.coppertivles.ru, www.coppertvles.ru, www.coppertikles.ru, www.coppertkles.ru, www.copperti,les.ru, www.coppert,les.ru, www.coppertibles.ru, www.coppertbles.ru, www.coppertigles.ru, www.coppertgles.ru, www.coppertitles.ru, www.copperttles.ru, www.coppertiyles.ru, www.coppertyles.ru, www.coppertiules.ru, www.coppertules.ru, www.coppertijles.ru, www.coppertjles.ru, www.coppertimles.ru, www.coppertmles.ru, www.coppertinles.ru, www.coppertnles.ru, www.copperties.ru, www.coppertilues.ru, www.coppertiues.ru, www.coppertil8es.ru, www.copperti8es.ru, www.coppertil9es.ru, www.copperti9es.ru, www.coppertiljes.ru, www.coppertijes.ru, www.coppertil0es.ru, www.copperti0es.ru, www.coppertilmes.ru, www.coppertimes.ru, www.coppertilpes.ru, www.coppertipes.ru, www.coppertiloes.ru, www.coppertioes.ru, www.coppertils.ru, www.coppertilexs.ru, www.coppertilxs.ru, www.coppertiless.ru, www.coppertilss.ru, www.coppertilews.ru, www.coppertilws.ru, www.coppertilers.ru, www.coppertilrs.ru, www.coppertilefs.ru, www.coppertilfs.ru, www.coppertilevs.ru, www.coppertilvs.ru, www.coppertilecs.ru, www.coppertilcs.ru, www.coppertileqs.ru, www.coppertilqs.ru, www.coppertileas.ru, www.coppertilas.ru, www.coppertileys.ru, www.coppertilys.ru,

    Other websites we recently analyzed

    1. Berufsverband Tiergestützte Therapie, Pädagogik u. Fördermaßnahmen
      Homepage des Berufverbandes tiergestuetzte Paedagogik, Therapie und Foerdermaßnahmen. Informationen zum Thema tiergestuetzte Arbeit aus Forschung und Praxis.
      Germany - 217.160.233.198
      Server software: Apache
      Technology: CSS, Html
      Number of meta tags: 4
    2. gtib.cn.com
      China - 103.232.215.150
      Server software: Tengine/1.4.2
      Technology: Google Adsense, Html, Javascript, Php
      Number of Javascript: 2
      Number of meta tags: 1
    3. medicalmalpracticelawyerpennsylvania.com
      Houston (United States) - 108.167.131.22
      Server software: Apache/2.2.27 (Unix) mod_ssl/2.2.27 OpenSSL/1.0.1e-fips DAV/2 mod_bwlimited/1.4
      Technology: Html
      Number of meta tags: 1
    4. EQ Logik - Sönke Wulff
      Germany - 213.203.239.230
      Server software: Apache/2.0.55 (Debian) FrontPage/5.0.2.2635 PHP/4.4.2-1+b1 mod_ssl/2.0.55 OpenSSL/0.9.8c
      Technology: Html
      Number of meta tags: 1
    5. Fasching-Karneval-Shop
      Spezialist für Karneval, Fasching, Halloween Oktoberfest Weihnachten, Nikolaus, Ostern, 60er Jahre, 70er Jahre, 80er Jahre, Mottopartys, Themenpartys, Karnevalskostüme, Faschingskostüme, Perücken, Brillen, Bärte, Jungesellenabschied und Zubehör
      Germany - 62.104.45.105
      Server software: Apache
      Technology: CSS, Html, Javascript, jQuery UI
      Number of Javascript: 11
      Number of meta tags: 5
    6. Hoststar - Webspace und Hosting mit vielen Vorteilen - Top Webhosting zum sensationellen Preis
      Wir bieten Ihnen Webhosting, Reseller-Hosting, Domains und vServer für Ihren Internetauftritt bereits ab CHF 5.90 pro Monat.
      Germany - 5.9.101.76
      Server software: Apache
      Technology: CSS, Html, Html5, SVG
      Number of meta tags: 3
    7. Harry Sturm & Associates Inc
      Check out this GoDaddy hosted webpage! http://hsa-recruiting.com.
      Scottsdale (United States) - 97.74.42.79
      Server software: Microsoft-IIS/7.0
      Technology: CSS, Html, Javascript, jQuery, jQuery UI
      Number of Javascript: 4
      Number of meta tags: 3
    8. AAU Golf > Home
      United States - 12.179.190.211
      Server software: Redirector/1.0
      Technology: CSS, Html, Javascript, jQuery, jQuery Hover Intent, jQuery UI, comScore, Google Analytics, Google Publisher Tag, DotNetNuke
      Number of Javascript: 12
      Number of meta tags: 7
    9. jelenka.eu - Na úvod
      Czech Republic - 89.185.253.48
      Server software: Apache
      Technology: CSS, Html, Html5, Javascript, jQuery, jQuery Cycle, Php, Swf Object
      Number of Javascript: 11
      Number of meta tags: 3
    10. Hi-Tact – Singapore's Scaffolding Solutions
      Singapore - 103.11.189.21
      Server software: Apache
      Technology: CloudFlare, CSS, Google Font API, Html, Html5, Javascript, jQuery, Php, Pingback, Revslider, SVG, Wordpress
      Number of Javascript: 12
      Number of meta tags: 3

    Check Other Websites